SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027482 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027482
Domain Number 1 Region: 2135-2257
Classification Level Classification E-value
Superfamily CalX-like 2.09e-24
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1890-2014
Classification Level Classification E-value
Superfamily CalX-like 1.19e-23
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1776-1890
Classification Level Classification E-value
Superfamily CalX-like 2.75e-22
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 4 Region: 2016-2132
Classification Level Classification E-value
Superfamily CalX-like 1.28e-20
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 5 Region: 2258-2371
Classification Level Classification E-value
Superfamily CalX-like 1.96e-19
Family CalX-beta domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027482   Gene: ENSGALG00000017041   Transcript: ENSGALT00000027534
Sequence length 3183
Comment pep:known_by_projection chromosome:Galgal4:1:170636418:170751330:-1 gene:ENSGALG00000017041 transcript:ENSGALT00000027534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGERGRRCPPPAGTMQAFLAVPRRLPAGLLLLAGCVCLGLPDPPLPPGRAAVSSPWGPEA
ATPVVVANRGLRVPLGRSAWLDPTRDLVLQVQPGYRCHLTVLDEDPLWQRPGRLEPRFPC
DFGPRDVRYSHLGGRSPARDRVRLQLRYDSPSRALVLPLVLEVEVLFTQLEIVTRNLPLV
VERLRGTSSPLDARSLEFAFEPGRQRCRVGLLPSLTGLPRYGEILNYPTAVAMPVGGSVE
AVGDGPVPASMWDCEEFLRLGLRYRHTAAGSSPNRDLVPLVAELWEAAGGRALLKREYFQ
VLVRIRGGMENVAPKPSFMAMLMMEVDQFVLTALTPDMLAAEDTESPPDLLLFNITSPFG
PGQGYMVSTDDRSLPISSFSQRDVRELRVAYQPPVEDSDRERLFELELEVLDPEGAASEP
FAFVIVVKPMNTLAPVVTRNTGLVLYEGQSRPLSDPGPSPNLVISDEDDLEQVQVSVVAG
LRHGHLTLLEDTPASAAPRKHFTVAELAAGRVIYQHDGSESPLSDNLVLRLEDGGSRHRV
EFLFPITLVPTDDQPPLLNANTGLAIAEGETVPITTRALSATDIDSQDAILLFTVESGPS
AGQLLLRQAQPPPGWEEEEEDEGFSWRRVSGVVGSSLIYEKPVREWLQQDIVEGRLYYHH
FGPHSPGPGVVLDQFVFRVQDDNDPPNRSGPQTFVIRVHPVDRLAPELHSSSSLHLIVAE
QQVTPLRRKHLCYTDQDSGDRELRYTVTQPPTDTDSNHSPDEHGARLGSLVLTEDHSVEV
THFTQAQINHHKISYRPPQEELGVAPHLIQFHYQVEDAAGNAAEGTFTIYLQPVDNQPPE
ITNTGFTLPEGGSHVLSPTELDASDTDTELAHLRFILTQAPRYGQLQLSGYSLILGGAFG
LEDIRQGRVVYVHSGAETNSDTCRLDVSDGVHVVPITLKMNVHPVDDEIPTLRLAPGTVG
SYLDVLENGAAEITANVIQGTDEDTDDLMLTFIVEDPPQHGSILVQGVPAERFSQRDVLD
GAVVYAHTSGEIGLLPKEDTFNLTLSDLSEEWNIRGNVVQGVSVLVTILPVDNKAPEIFV
GEQFRVMEGDKRVITPAHLRAEDVDTPSDDILCTIVAQSTSGYVENISPAPGSEKSRAGI
AISAFTLKDLRQRHIFYVQSIHKGVEPVEDRFAFRCSDGINFSQRHVFPIVIMPMNDEEP
EIFIREFVVMEGMSLVIDTPILNAVDGDIPADKLTFTITRLPRHGHIVNQLINGTVLAES
FTLDQITESSNILYEHDDSETREDNFEVKLSDGKHTTVKTIFIMVIPVDDETPRMAINDG
LEIEIGETRTIHNRILKATDLDSEDKTLTYIVRYGPGQGLLQRLKPSGGVENITLGMNFT
QDEVDRNLIRYMHFGREGVRDLIKFDVTDGINPLIDRYFYVTVGSIDIVFPDVISKGVSL
KEGGKVTLTTDLLSTSDLNSPDENLVFTITRAPVRGHLECTDQPGVPISTFTQLLLAGNK
IYYIHTSEDEVKMDSFEFEVTDGYNPVFRTFRISISDVDNKKPIVTIHNLVVSENEYKLI
TPFELTVEDRDTPDPLLKFIITQIPVHGQIMFNNSKPVTTFTKQDLNENLISYKHDGTES
VEDSFSFTVTDGTHTDFYVFPNTVFETRRPQTMKIQIMAVDNSIPQIVTNKGAQTLRILA
TGHVGFLITNKVLKVEDRDSLHIALKIRITEGPRHGFLIHLGKGNHSISQFTQADIDDMK
ICYVLRAGDNATSDIFHFIVEDSGGNKLKNQHFRLNWAWISLEKEYYLVNEDSKYLDVVL
KRRGYLGETSFISISTRDGTAKKDKDFRGKAQKQVQFNPGQTLATWRVRILIDGEHERSE
SFQIVLSEPVMAVLEFPSVSTVEIIDPGDESTVFIPQSTYTIEEDVGELFIPVRRSGDVS
QELMVICYTQQGTATGTAPTSVLSYSDYISRPEDHNSVLRFDKDEREKTCRVVIIDDSLY
EEAETFDVLLSMPMGGRIGTEFASTRITIVPDKDDEPAFYFGNDEYYVDESAGYVEVHVW
RTGTDLSKAASVTVRSRKSESRTAEAGVDYVGISRNLDFAPGVSMQTFRVVILDDLGQPV
LEGAEKFELVLRMPMNAALGEPSKATIFINDSVSDLPKMQFKEPVYVVNENDGQISAMIY
RSGDIQYTSTVRCYTRQGSAQVMIDFEERPNTDSSIITFLPGETEKPCTLVLMDDTFHEE
DEELRLVLGTPRSDSSFGASIGEQNETLIKIQDDADKAIIKFGETKFSVSEPKDTRQVAV
VKIPVIRLGDTSKVSVVRVHTKDGSAISGEDYHPISEEIEFKEGETQHFVEIEVLFDGVR
EMREAFTVHLKPDENMVAEIQTAKAIVYIEEMNSMADVTFPSVPQVASLLIYDDTSRAKD
RTSPVAGYPVICITACNPKYEDFDKTGSICASENINNTLTQYRWLVSAPTGPDGVTSPMK
EVDFDTFFTSSKMITLDSIYFQAGSRVQCAARAVNSDGNEGLELMSPIVTISTSEVGLCQ
PRVSGVVGAEPFSAKLRYTGPEDPAYANLIKLTVTMPHIDGMLPVISTRELSNFELTLSP
DGTRVGNHKCSNLLDYTEVKTHHGFLTDATKNSDVIGETIPYQYSPAIRGFNTLRFYRNL
NLEACLWEFVSYYDMSELLTDCGGTIGTDGQQVLNLVQSYVTLRVPLYVSYVFHSPVGVG
GWQHFDLQSELRLTFVYDTAILWKDGIGSPPEAELQGSLYPTSMRISEEGRLVVNFKTEA
RFHGLFVMSHPASSLTSMVMSADHPSLTFSLSLIRSEPTYNQPVQQWSFVSDFAVRDYSG
TYMVKLIACTTAPHQEYSLPVICNPREPITFDLDIRFQQVSDPVAAEFSLNTQMFLLSKK
TLWLSDGSMGFGQESDVAFSEGDVIYGRVMVDPVQNLGDSFYCSIEKVFLCTGADGYVPK
YNPSNTEYGCLADSPSLLYRFKIVDKAQPETQATSFGDVLFNAKLAIDDPEAISLVKQPG
SDGFKVDSTPLFQVSLGREWYVHTIYTVRSKENANRGIGKRSVEQQYHSLFSGGSPAGST
QRRHKRGVVGAPELARDIGVENNRGTNIQHIALDRTSRKQVPQREVAVSGVLPRELNSQS
SGVSVVTIVGGAAAIFLAICLITIIILLLKRRQNSEKKEATKKSGSNEPMMLPNSYTSDS
SEV
Download sequence
Identical sequences ENSGALP00000027482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]