SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027736 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027736
Domain Number 1 Region: 155-181,211-450
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-61
Family Nuclear receptor ligand-binding domain 0.00000000409
Further Details:      
 
Domain Number 2 Region: 102-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-24
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027736   Gene: ENSGALG00000017195   Transcript: ENSGALT00000027789
Sequence length 470
Comment pep:known chromosome:Galgal4:1:182430989:182465988:1 gene:ENSGALG00000017195 transcript:ENSGALT00000027789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAQPPRAGQEPSLECVLYKAEPPLLPGAYGPPAAPDSLPSTSAAPPGLYSPLGLNGHHQA
LGFPAAVLKEGLPQLCPPYLGYVRPDTETSQSSQYSFESLPQKICLICGDEASGCHYGVL
TCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKL
NKMKVVRTLDVALQQPAVLQDETQSLTQRLSFSPNQEIPFVPPMISVLRGIEPEVVYAGY
DNTKPETPSSLLTSLNHLCERQLLCVVKWSKLLPGFRNLHIDDQITLIQYSWMSLMVFAM
GWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLSMWQLPQEFVRLQVSQEEFLCMKA
LLLLNTIPLEGLRSQSQFDEMRTSYIRELVKAIGLRQKGVVANSQRFYQLTKLMDSMHDL
VKQLHLFCLNTFLQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences ENSGALP00000027736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]