SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000027822 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000027822
Domain Number 1 Region: 119-362
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-30
Family Prokaryotic proteases 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000027822   Gene: ENSGALG00000017244   Transcript: ENSGALT00000027875
Sequence length 372
Comment pep:known_by_projection chromosome:Galgal4:1:188021745:188022863:-1 gene:ENSGALG00000017244 transcript:ENSGALT00000027875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLTTLILLLCAAKDVMPSSPHWKPTWPSYRVPVILPQSTFHLDKPQFDAEARLEVASP
CGPECHKSSPLPTYEEVKNYLSYETLYANGSLTETEVGIYILSSGGDESRGKSRTKRQIY
GYDSRFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAAHCIHDGKSYVKGAQKLR
VGFLKPRGKNGSKGANITSSAMPEKMKFQWIRVKRTHVPKGWIKGNANDIGMDYDYALLE
LKKPHKRKFMKIGVSPPARHLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDA
QPGASGSGVYVRMWKRQNHKWERKIIGIFSGHQWVDMNGTPQDFNVAVRITPLKYAQICY
WIKGNYLDCREG
Download sequence
Identical sequences E1C744
9031.ENSGALP00000027822 XP_001234471.2.86415 XP_417210.3.86415 ENSGALP00000027822 ENSGALP00000027822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]