SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000028694 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000028694
Domain Number 1 Region: 26-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.54e-75
Family Eukaryotic proteases 0.00000873
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000028694   Gene: ENSGALG00000013548   Transcript: ENSGALT00000029351
Sequence length 260
Comment pep:known chromosome:Galgal4:Z:16520886:16525301:1 gene:ENSGALG00000013548 transcript:ENSGALT00000029351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVFFTLSTSAAIVLLILPGDLCVDIIGGHEVAPHSRPFMAMLKGKEFCGGALIKPSWVL
TAAHCNLEGGRVILGAHSRTKREEEKQVIEIAEEIRYPDYCPKSEEHDIMLLKLKKRAKI
NSAVKVIPLPTSGDDLKQGTICSVAGWGQISKRGNKMSDTLREVNVTVISRRICNDKKHY
RNKPRITDNMICAGSKRGDKDSCRGDSGGPLICNNVMKGITSFGKPRCGVPDGPGVYTRI
TDKYLKWIRKTIGGDLLTGF
Download sequence
Identical sequences F1N917
ENSGALP00000028694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]