SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000029335 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000029335
Domain Number 1 Region: 817-896
Classification Level Classification E-value
Superfamily DEATH domain 1.84e-19
Family DEATH domain, DD 0.00014
Further Details:      
 
Domain Number 2 Region: 151-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000673
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 241-292
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000994
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 4 Region: 295-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 44-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000105
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000029335   Gene: ENSGALG00000018998   Transcript: ENSGALT00000029975
Sequence length 907
Comment pep:known_by_projection chromosome:Galgal4:13:9652962:9657656:-1 gene:ENSGALG00000018998 transcript:ENSGALT00000029975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGDSCRTWSRWCPWRWLSSHVPTGAQQSVTVASPASGASPDLLPHFLLEPDDVYIVKNKA
VSLACRATPATQIYFKCNGEWVHQGDHITQRSTDRGTGLPVMEVRIEITRQQVEKLFGLE
EYWCQCVAWSSSGTTKSQKAFVRIAYLRKNFEQEPTAREVSIEQGVVLPCRPPEGIPPAE
VEWLRNEELVDPALDANVLVTPEHSLVLRQARLADTANYTCVAKNIVARRRSASAAITVY
VNGGWSTWTQWSGCSTSCGRGWQKRSRTCTNPTPLNGGAFCEGQNVQKSACTTLCPVDGD
WSEWSKWSVCGAECTHWRSRECSEPAPRNGGQECHGPELETHNCTSELCSPMCPRGADNL
PHAATPGAEDLALYVGLIAVAVCLVLLLLVGVLVYCRKKGGLDADVADSSILTTGFQPVS
IKPSKADNLLTIQPDLSTATMTYQGSLCPRQDGPAKLQLPNGHLLSPLGAGRHTLHHSSP
AAEGADFVARLSTQSYFRSLPRGTANMAYGTFNFLGGRLMIPNTGVSLLIPPDAIPRGKI
YEVYLTLHKHEEVRLPLAGCQTLLSPIVSCGPPGVLLTRPAILAMGHCVEAGAEHWSLRL
KKQSCEGTWEDVLQLGAEPRTELYYCQLEAQACYIFTEQLGRFALVGESLSMAASKRLKL
VLFAPTACPSLEYNIRVYCLSDTQDALKEVMQLEKQMGGQLIGAPRVLHFKDSYHNLRLS
IHDMPSSLWKSKLLASYQEIPFYHIWSGLQPYLHCTFTLERLSPSTCELACKIWIWQVEG
DGQSFTINCNIAKDTRFSDWLVPDSEVGSPALVGPSAFKIPFLIRQKIISSLDTPCARGA
DWRTLAQKLNLDSHVSFYASKPSPTAMILNLWEARHFPNGNLSQLAAAVAEVGKQDSALF
AVSEAEC
Download sequence
Identical sequences ENSGALP00000029335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]