SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000029435 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000029435
Domain Number 1 Region: 55-164
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-25
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 260-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 7.02e-19
Family Platelet-derived growth factor-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000029435   Gene: ENSGALG00000017179   Transcript: ENSGALT00000030073
Sequence length 367
Comment pep:known chromosome:Galgal4:1:181229612:181286186:1 gene:ENSGALG00000017179 transcript:ENSGALT00000030073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFVAFLWVLVCQSCRCREPSPTTDHSWMVQVHGAESNHLTDLYRKEETISVAGNGCIHS
PRFPSSYPRNLLLTWRLHSPESTRIQLAFDNQFGLEEPENDICRYDFVEVEDLSETSTVI
RGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKICYSLVDDFQHAASETNWESVT
SSVSGVSYPSPSVTDPTLTAEALDQTIAAFDTVEDLLKHFNPDSWKEDLENLYTESGHHY
RGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTNAVFFPRCLLVQRCGGNC
GCGTSNWKSCTCMSGKTVKKYHEVLKFVPEAEHPRKKGKARKNMALVDIQLDHHDRCDCI
CSSRPPR
Download sequence
Identical sequences ENSGALP00000029435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]