SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000029849 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000029849
Domain Number 1 Region: 2-178
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-67
Family Eukaryotic proteases 0.000004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000029849   Gene: ENSGALG00000014755   Transcript: ENSGALT00000030486
Sequence length 180
Comment pep:known scaffold:Galgal4:AADN03009585.1:654:2195:1 gene:ENSGALG00000014755 transcript:ENSGALT00000030486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRIQVRLGEYNIDVQEDSEVVRSSSVIIRHPKYSSITLNNDIMLIKLASAVEYSADIQPI
ALPSSCAKAGTECLISGWGNTLSNGYNYPELLQCLNAPILSDQECQEAYPGDITSNMICV
GFLEGGKDSCQGDSGGPVVCNGELQGIVSWGIGCALKGYPGVYTKVCNYVDWIQETIAAY
Download sequence
Identical sequences ENSGALP00000029849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]