SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000030498 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000030498
Domain Number 1 Region: 219-270
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000353
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000030498
Domain Number - Region: 533-599
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0157
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000030498   Gene: ENSGALG00000011882   Transcript: ENSGALT00000031134
Sequence length 828
Comment pep:known_by_projection chromosome:Galgal4:2:43644683:43666625:1 gene:ENSGALG00000011882 transcript:ENSGALT00000031134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGGGGGGDERLALWPGSSFTISLRAADNITVTIKLKPGVLPACLIRVKSGPRPELKIR
PGENVTLSFTCNTPEKYLMMEIQKNIDCVSGPCPFGDVHLYPPGLPRLNRIFIWDVKAST
KAGLELKFSAPLRQIQPGEMCPDLVSYNINSCIDKATVNIGTFCRNGSVSRVKLLGGVIM
SLHLPWNLTVATSGFNIANRSSIKRLCIIESILKGESSIMLMSPNYPLGFPEDELMTWQF
VVPSNMRASVFFHDYSLSNCERKEERVEYYIPGSVSNPEVFKLSDSQPANIAGSFNMSLQ
GCDQDAQNPGVLRLLFQVIVQHPQIDENVIHLVDLSKERNMTVTIHFEGWPRRTPLVSEP
MCLICKDPRTCDRVLTLASGATYKISFLCKDLSHLRITAEKGISCVGLRWCESRIYSLSV
PKTITQLPVQLHKFIWKLIAPEEINIEITSPSLKLRQHLPEQNCNTSYSYSIISATPETE
MNVGIFCPGGAIEKIQLRNNITISLKTFGKGFLNESNHQDLKMSFVPHIKDECTFTVSPD
SKAKTYLQTPNSHYGLPPYVSISWYIIVPSKQVARLGFSTDRMGITCETGRAYVNIKEQM
PGAEETVRREDELLPQPRNMHYNFWVNISNCKPVDPMQLSLKFWVTFVEKQIDLAVIVGV
LAGFGVLAAIGLTVCCIKKKKKKSQNPMVGVYNTNVNTQMPGKQRLFKKDRKTNESHVYA
VIDDAMVYGHLLKESNGSVTPEVDVYQPFDGPMGSLPPSPPPFSFRKDVKHSPNTEEPPL
LAETDHDAYTFAHQKSGELEDNGEGNAKNNGDTSMSLLENKERDSLEE
Download sequence
Identical sequences ENSGALP00000030498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]