SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000030720 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000030720
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.61e-55
Family N-terminal domain of xrcc1 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000030720
Domain Number - Region: 339-365
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0207
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000030720   Gene: ENSGALG00000017493   Transcript: ENSGALT00000031356
Sequence length 376
Comment pep:novel chromosome:Galgal4:1:193362031:193364866:1 gene:ENSGALG00000017493 transcript:ENSGALT00000031356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVKISHVVSFSSQDPRYPVENLLCPDGRRPWLSCPQERSRQLKVELQLERAVPIGYID
VGNWGCAFLQIEVGRSSWPLDRPYLTLVPSVALMTPADSKLDRNRCGVRMFKEADFLVLA
AGQKWDRLRLTCSQPFRHRGQFGLCFIRVRTPLDPEPWGGTEQWDQQLSAPRSSQEEEQL
KSSLQQLEPSAACRAWSPAHLSRPARMVLSAAQSRAVRPPPRGSAGAPRSSTEQGQPAAR
GAALEVPAAPKRARRQPGSRQRARRAVGSSLQPLSRNPGPGGRATTHGHNASGGESSGGE
MALCPICSGSFSTALLPAHASRCGEEDSDAEVELLSSASSPVPCPICGLCFTAAEVERHC
STCGEERLSPTAPWGR
Download sequence
Identical sequences ENSGALP00000030720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]