SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000031075 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000031075
Domain Number 1 Region: 40-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000562
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000031075   Gene: ENSGALG00000019934   Transcript: ENSGALT00000031711
Sequence length 98
Comment pep:known_by_projection chromosome:Galgal4:3:65237827:65240813:-1 gene:ENSGALG00000019934 transcript:ENSGALT00000031711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKKNGQTVCGPGQNKQLQSVNYRLMSAYRNLPLVLKKKCLVQATPWTPCSRTCGIGIS
SRVTNENKKCEMKKEKRLCFIQPCLTNILKTVKVPSNL
Download sequence
Identical sequences ENSGALP00000031075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]