SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000031163 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000031163
Domain Number 1 Region: 54-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000031163
Domain Number - Region: 13-43
Classification Level Classification E-value
Superfamily PKD domain 0.000981
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000031163   Gene: ENSGALG00000019987   Transcript: ENSGALT00000031799
Sequence length 247
Comment pep:known_by_projection chromosome:Galgal4:3:47538737:47606787:-1 gene:ENSGALG00000019987 transcript:ENSGALT00000031799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVPQPGTLKLSHLQEGTYIFQLTVTDTAGQRSMDNVSVTVLPMTHSAVACVGVCSRYQF
ICDDGCCIDITFACDGVKQCPDGSDETFCQNLSPGRKTVTHSAPSTTQQRTAGLTEKTDE
NLPAENTLKATVRNQLLLSLDADTSNQSLSQGPKKQNSGFVPDNSSSGKKTGDKNGNGLI
VPKRDQLGDGHPVPETGAVLPLALGLAITALLLLMVACRLRLVRQKLKKARPITSEESDY
LINGMYL
Download sequence
Identical sequences ENSGALP00000031163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]