SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000032057 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000032057
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000406
Family ATI-like 0.047
Further Details:      
 
Domain Number 2 Region: 673-736
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000929
Family BSTI 0.063
Further Details:      
 
Domain Number 3 Region: 784-842
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000536
Family ATI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000032057   Gene: ENSGALG00000020492   Transcript: ENSGALT00000032694
Sequence length 2726
Comment pep:known_by_projection chromosome:Galgal4:5:14423044:14459159:1 gene:ENSGALG00000020492 transcript:ENSGALT00000032694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEYFVSTVLSKDSCSTWGGGHFSTFDKYQYDFTGTCNYIFATVCDESSPDFNIQFRRG
LDKKIARIIIELGPSVIIVEKDSISVRSVGVIKLPYASNGIQIAPYGRSVRLVAKLMEME
LVVMWNNEDYLMVKNNPEIHALSTKLQNETVSFPFLFLSSSLQIKKKNKNSSSSQVLTEK
KYMGKTCGMCGNYDGYELNDFVSEGKLLDTYKFAALQKMDDPSEICLSEEISIPAIPHKK
YAVICSQLLNLVSPTCSVPKDGFVTRCQLDMQDCSEPGQKNCTCSTLSEYSRQCAMSHQV
VFNWRTENFCSVGKCSANQIYEECGSPCIKTCSNPEYSCSSHCTYGCFCPEGTVLDDISK
NRTCVHLEQCPCTLNGETYAPGDTMKAACRTCKCTMGQWNCKELPCPGRCSLEGGSFVTT
FDSRSYRFHGVCTYILMKSSSLPHNGTLMAIYEKSGYSHSETSLSAIIYLSTKDKIVISQ
NELLTDDDELKRLPYKSGDITIFKQSSMFIQMHTEFGLELVVQTSPVFQAYVKVSAQFQG
RTLGLCGNYNGDTTDDFMTSMDITEGTASLFVDSWRAGNCLPAMERETDPCALSQLNKIS
AETHCSILTKKGTVFETCHAVVNPTPFYKRCVYQACNYEETFPYICSALGSYARTCSSMG
LILENWRNSMDNCTITCTGNQTFSYNTQACERTCLSLSNPTLECHPTDIPIEGCNCPKGM
YLNHKNECVRKSHCPCYLEDRKYILPDQSTMTGGITCYCVNGRLSCTGKLQNPAESCKAP
KKYISCSDSLENKYGATCAPTCQMLATGIECIPTKCESGCVCADGLYENLDGRCVPPEEC
PCEYGGLSYGKGEQIQTECEICTCRKGKWKCVQKSRCSSTCNLYGEGHITTFDGQRFVFD
GNCEYILAMDGCNVNRPLSSFKIVTENVICGKSGVTCSRSISIYLGNLTIILRDETYSIS
GKNLQVKYNVKKNALHLMFDIIIPGKYNMTLIWNKHMNFFIKISRETQETICGLCGNYNG
NMKDDFETRSKYVASNELEFVNSWKENPLCGDVYFVVDPCSKNPYRKAWAEKTCSIINSQ
VFSACHNKVNRMPYYEACVRDSCGCDIGGDCECMCDAIAVYAMACLDKGICIDWRTPEFC
PVYCEYYNSHRKTGSGGAYSYGSSVNCTWHYRPCNCPNQYYKYVNIEGCYNCSHDEYFDY
EKEKCMPCAMQPTSVTLPTATQPTSPSTSSASTVLTETTNPPVTSKITVSRTSSSSPLVT
IKSTTEIFFTPKEHTTSIFTMPSMTTTVTAPSITTSAKRTIFTEPKSTPTASATTASVET
EKISFTTPLLETTVKKEMTTISIPYTTSQIATFSKPELTTRPFSTNSLPPRRCTNLERIF
CFPQKVQEDAEGTELVQFLPHILGRSRKGKVRDEATVAVTHKRPTTPHAVPHLITQKTTP
VTLASSISKTSVSTEASSPEVPLTRLSLTPSSLPATSAVSVSSPSSPFSTRLRPSHPVPM
AASKTTVPPLTTEKTTPITSFTSTSRTSVFSEASPTSSPEIPLTTTSPAPSSTLSTRLPT
PAPSTLFSTLPPISMPKTVPTTLRPKPSSPTTSASTELLIPASSTPSTAKTSLLPSSASS
PYSTVSSTVLSTSHPGKACLIFLHLLIFNIQRTCACFSATSTHKKTTVLHVVPYIITEKT
TPTMSTTSTSKTSISSKATSTSSPEVPLTTTSPALSSTLSTRLSSPVPSTLFSTSPSTST
PKPTSTTLRLKPSSLTTSAPAESPTTVFVIPSTAKTSLLPSVSSPLSTVSSTAMKTSQPT
STHKMTTVPHIVPSVTTEKTTPTVSATSTSKTSISSEASLTSSPEIPLTTTSSAPSSTLS
TSLPSAAPSTLSSTTKLRPTTLRPKPSSMSTSAPTESPTPASSTPSTAKTSLLSLSPSSF
STVSSTAMSTSYPKIRATTHKMTTLLHMVPYITTEKTTPTTSSVSTSKTSISSEASPTSS
PEIPLTTTSSAPSSTLSTRLQTPAPSTLLSTLPSPSTPKPTPTTLRLKPSSLTTSAPTES
PTPASSTLSTAKTSLLPSSASSPFSTISSTVRTTSLPASPTSSPGVPLTMTSPALSSTLS
TRLLSAAPSTQSTLLPSSTTKLMPTTLQPNPSSLTTSALTEPPSPIFSALSTAKTSPLPS
STSFPFSTVPLTILSTLQPCNTNHVVFTFHVVITLLTFAASTHKMTTVPHIVPSVTTEKT
TPTVSATSTSKTSISKVPLTTTSSAPSITLSTSLPSTAPSTLFSTLLPTSTPKSTPTTLR
PKLSPLTTSAPTESPTPASSTLSTAKTSLVPSSASSPFSTISSTVRTTSLPGMYFSCSSS
SHPSFLHSAHTTSTSTHKKTTVLHVVPYIFTEKTTVMPATTSISKTSISSEASPTSSPEV
PLTTTFPAPSSALSTRLPSAASSTLFSTSPPTSTPEPTLTTLSPSTFLSSESATYSSSTH
NTTFSFTPPGETFSVAFPTAASAKSSPVVIPSLLPTTIKFAPSMTTTASTEIPSIEQTSI
QTTTLTTTHTTSSLSVTSGLSTSLSPVRPSTVPQEQQASCSALMFTWGGGYNLSSSREPD
ENHAGAEYGDDQKKVDQYVLLSKWHYAFNLEMKKQNLKNDQIKNFSSPLHPSSKFCKKVE
YEENITYKGCSANVTLSRCEGLCPSSTKLNVENMVFSAACSCCRPLQLHKEKFQLPCEDP
DNPGKRLTKEITVFGGCVCNFDSCIQ
Download sequence
Identical sequences ENSGALP00000032057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]