SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000033049 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000033049
Domain Number 1 Region: 855-937
Classification Level Classification E-value
Superfamily DEATH domain 2.47e-22
Family DEATH domain, DD 0.00000878
Further Details:      
 
Domain Number 2 Region: 246-297
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000144
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 156-247
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000717
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 300-354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 5 Region: 49-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000444
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000033049   Gene: ENSGALG00000004569   Transcript: ENSGALT00000033690
Sequence length 945
Comment pep:known chromosome:Galgal4:6:11331410:11360275:1 gene:ENSGALG00000004569 transcript:ENSGALT00000033690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPARRLLLPFFLLLLLPLHLRWALAAAGLEYSEVLPDSFPSAPAETLPHFLREPQDAYI
VKNKPVELVCRANPATQIYFKCNGEWVNQNDHVTTESLDEVTGLLVREVQIEVSRQQVEE
LFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLEQEVLLQCRPPEG
VPQAEVEWLRNEDVIDPTQDTNFLITIDHNLIIKQARLLDTANYTCMAKNIVAKRRSTTA
AVIVYVNGGWSTWSEWSPCNNRCGRGWQKRTRTCTNPAPLNGGSFCDGQPFQKVTCTTLC
PVDGAWTEWSKWSACSTECTHWRSRECSAPAPRNGGKDCSGGLLDSKNCTDGLCLHNKRV
LSEPKSHLLEATGDVALYAGLVVAIFVFIVILMAVGVVVYRRRCRDFDTDITDSSAALTG
GFHPVNFKTARHDNPQLLHPSMQPDLTANAGVYRGPMYALQDSSDKIPMTNSPLLDPLPN
LKIKVYNSSTTSSSPGLHDGTDLLGGIPAVGTFPGDSSSQFVNMRNKAQQGSQHLLSLPR
EHGTSASGTFSYLGGRLTIPGTGVSLLVPHGAIPQGKFYEIYLVINKAESGLLPSEGTQT
VLSPAVTCGPTGLLLCRPVVLTIPHCADVSSSDWIFQLKTQSHQGNWEEVVTLDEETLNT
PCYCQLEAKSCHVLLDQLGTYVFVGESYSRSAIKRLQLAIFAPAICTSLEYSLKVYCLED
TPDALKEVLELERTLGGYLLEEPKPLPFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPF
YHIWSGSQRALHCTFTLERYSQASTELTCKICVRQVEGEGQIFQLHVTLGEHANSFDTLH
SHNSSAPTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEAEHQDDGDLNTLASALEEMGKSEMLVVMATEGDC
Download sequence
Identical sequences E1C228
ENSGALP00000033049 NP_001026396.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]