SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000033285 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000033285
Domain Number 1 Region: 147-402
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-71
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 79-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-31
Family Nuclear receptor 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000033285   Gene: ENSGALG00000027907   Transcript: ENSGALT00000033927
Sequence length 418
Comment pep:known_by_projection chromosome:Galgal4:Z:58199293:58207595:-1 gene:ENSGALG00000027907 transcript:ENSGALT00000033927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSSWRDPQEDVAGGTPSGPNPAAQPAREQPPQQQGGSAAPHTPQTPSQPGPPSTPG
TAGDKGPGQQGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRAN
RNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYL
SGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQI
TDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQ
VEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPS
RFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
Download sequence
Identical sequences A0A226MYL0 A0A226P7M6 F1NJL8
XP_003643114.1.86415 XP_021236821.1.32913 ENSGALP00000033285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]