SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000033373 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000033373
Domain Number 1 Region: 161-274
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-37
Family Link domain 0.0038
Further Details:      
 
Domain Number 2 Region: 269-357
Classification Level Classification E-value
Superfamily C-type lectin-like 6.12e-25
Family Link domain 0.0011
Further Details:      
 
Domain Number 3 Region: 51-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000911
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000033373   Gene: ENSGALG00000021135   Transcript: ENSGALT00000034015
Sequence length 359
Comment pep:novel chromosome:Galgal4:10:12534846:12538880:1 gene:ENSGALG00000021135 transcript:ENSGALT00000034015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPLLLKATLLRMVNSYHPFYNGFYYNHVMNDDDNGNEKVVDFNGVRLVVETSKDPIY
SFSGVNVTLPCHYHHEPESEAKHKIRIKWSKLRDDYTKEQDVLVAIGKTYMAFGDFQGRA
HLHRAGQREASLLISDVRLQDDGKYRCEVIDGLEDASDVVELRLRGIVFPYQPPRGQYSL
NFHEAERVCQEQGSLIATFHQLFQAWSEGLDWCNAGWLADGTVHYPIRLPRKPCGGVHLA
PGIRSYGPRHRHLHRFDVFCFSSRLRGEVFYLEHPTRMTLEEAKQACQDAGAEIAKVGHL
YSAWKFHGLDRCDAGWLADGSVRYPIAKPRPNCGPAEPGVRSFGFPSKGRFGVFCYKER
Download sequence
Identical sequences E1BUN0
XP_413868.3.86415 ENSGALP00000033373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]