SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000034156 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000034156
Domain Number - Region: 94-133
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0157
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000034156   Gene: ENSGALG00000021526   Transcript: ENSGALT00000034799
Sequence length 295
Comment pep:known_by_projection chromosome:Galgal4:19:7196771:7200048:1 gene:ENSGALG00000021526 transcript:ENSGALT00000034799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKHVVKLLAAVAALLYCWCHSAVAQSFTAVKEMIFPSQVYLKELNAFKEQLEKLEMEFSR
IQGILQKSGITTLSSESSHCQRCSKTVLGAPVEVQPDPPPSVPGPPAVQLQPTAVPPPLP
PPPPPPPPPLPPPKLPAAPLLLKRGNGSKALLEPSVKKDAPMHITLKDLLNVKLRKTDSS
LRTDKAGSPARTRRALITVSDLQSVNLRSKSKPSAHVTSSLNTPPKNQLDLRKHLKKVNI
QRSPGGTPLNKENTECGTGLTPIMTQALRRKFQMAHPKSPSPARLSAANSFDEHK
Download sequence
Identical sequences ENSGALP00000034156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]