SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000034553 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000034553
Domain Number 1 Region: 30-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000034553   Gene: ENSGALG00000021688   Transcript: ENSGALT00000035199
Sequence length 159
Comment pep:known chromosome:Galgal4:28:891185:893874:1 gene:ENSGALG00000021688 transcript:ENSGALT00000035199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLLELLVLLRAVRPLPTPTSAPGNGSLAQCSPEQFHCSEPHDPQTDCYPLEWLCDGHP
DCDDGRDEWGCGASGSPAVPTAGGTETSAVPAPGRALPSRNHGRMWMLIVAVLLSCLVAV
GGIAAWGKSKAKSRSDIFGLESVSREQLVPDKSQADLFS
Download sequence
Identical sequences A0A1D5P2E9
ENSGALP00000034553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]