SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000035118 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000035118
Domain Number 1 Region: 166-223
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-18
Family C-type lectin domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000035118   Gene: ENSGALG00000022316   Transcript: ENSGALT00000035889
Sequence length 224
Comment pep:novel scaffold:Galgal4:JH375454.1:5895:10036:1 gene:ENSGALG00000022316 transcript:ENSGALT00000035889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSVAGKMTPMDDFRPASPDSFDNEDDYDDVSVSGLDRGYKPPAPNEDLQSQRSRGGVYI
LAGKPPPSNPSPVGNPKPSCGRGRPSVVVLYILVVLSFVVWVPLLALAMVKQVEIMAELE
LLRSNYTESQIHMLQELSDSRQERTWLRSGMRSYYRELWDITARICKAGPKKKCLAGWKD
FEESCYYFSTERMSWREAKEICDDRGAHLVIINSEQEQAFLKNS
Download sequence
Identical sequences ENSGALP00000035118 ENSGALP00000035118 9031.ENSGALP00000035118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]