SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000036103 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000036103
Domain Number 1 Region: 2913-3093
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-35
Family Laminin G-like module 0.00000468
Further Details:      
 
Domain Number 2 Region: 2313-2499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-33
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 2741-2905
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.13e-32
Family Laminin G-like module 0.0000586
Further Details:      
 
Domain Number 4 Region: 2139-2311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-29
Family Laminin G-like module 0.00081
Further Details:      
 
Domain Number 5 Region: 2508-2689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.38e-26
Family Laminin G-like module 0.0096
Further Details:      
 
Domain Number 6 Region: 858-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 7 Region: 808-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 8 Region: 751-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000322
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 279-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 10 Region: 1412-1463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family Laminin-type module 0.0077
Further Details:      
 
Domain Number 11 Region: 1053-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 1470-1520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 13 Region: 702-753
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 14 Region: 911-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 15 Region: 1518-1563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 16 Region: 406-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 17 Region: 960-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 18 Region: 478-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1004-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000036103
Domain Number - Region: 336-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 87-166
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000468
Family Galactose-binding domain 0.069
Further Details:      
 
Domain Number - Region: 1368-1393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000977
Family EGF-type module 0.086
Further Details:      
 
Domain Number - Region: 1099-1160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 1878-2095
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00497
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000036103   Gene: ENSGALG00000014615   Transcript: ENSGALT00000036890
Sequence length 3097
Comment pep:known chromosome:Galgal4:2:99400293:99499147:1 gene:ENSGALG00000014615 transcript:ENSGALT00000036890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMGSGGRWLLALLAAVSLLGAPGRGQPRGLFPAILNLASNAHISTNATCGEKGPEMFCK
LVEHVPGRPLRNSQCRVCDRHSANPKEQHPISSAIDGTNNWWQSPSIQNGRQYHWVTITL
DLRQVFQVAYVIIKSANAPRPGNWILERSIDGTEFKPWQYYAISDTECLTRYNITPRVGP
PTYKRDDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDPSQKLLDFTSARYIRLRLQRI
RTLNADLMTLSHHDPKELDPIVTRRYYYSIKDISVGGMCICYGHARSCPLDEITKKLQCQ
CEHNTCGESCNRCCPGYHQKPWRPGTISAGNKCEKCNCHNKAEDCYYNQTIADQKRSMNI
HGQYTGGGVCLNCSQHTTGINCEMCADGYFRPQKVSPYDDHPCYPCGCDPFGSLSSVCVK
DERQSDSQHGTWPGQCQCRDGYTGEKCDRCAFGYRGYPNCLRCNCSLIGSINEDPCAEPC
LCKENVEGENCDLCKPGFYNLQERNPEGCTECFCFGVSDVCDSLTWPISQISDMTGWLIT
DLYNAKGVQPQRGQFDGPRQISINNSDAVKVLKHTYYWSAPEPYLGNKLTAFGGDLKYTV
SYDIPMESVDSDILSSVDVIIQGSGQILSTRAAGLSLQPYEEYSNSVRLVSENFIDFNTK
KAIDRERLMTVLVNVTRLLIRANYNIAKKAVYRLDSVTLDNASANVIDLSSAPDVEFCEC
PQGYTGISCESCLPGYYRVDGILFGGICQPCKCNGHATECDTQGVCFACQHNTTGPFCDQ
CLPGFYGSPSQGTPEDCQPCACPLSSAANNFSPTCQLSEGEGIVCDKCLPGYTGSRCERC
ANGYYGNPLVPGQSCVPCECNGNVNPQEDGYCDTITGQCLKCVGNTAGLHCEKCADGYYG
DAVTEKSCRACECHVNGSLSSVCHHETGICDCKSDVIGQKCDKCLNGFYGLLTGLGCIPC
NCSQFGSISEDCNHQGQCHCLPGVAGEKCDRCAHGFHSLQKSGCTPCDCAHTQNNCNADS
GQCICPPHTRGPKCDLCEENHWGLSPKLGCKACNCSDSGSDSLQCDVLTGQCQCKAEFGG
QNCSRCALGYRDYPDCVACDCDLSGTKAEMCDDTKGLCGCEEETGICACKENVFGLQCSE
CKPGTFALSANNALGCTPCFCFGMSTSCLEVEDHVRIPITLTPDQSVLHVVAQSNLTGTV
EGVFSQFPDVLLDAAIVRKYLNTETFYWRLPEQFQGDQLMAYGGKLRYTVAFYALDGFGT
SNFEPQILMKGGRTSKLVIYVDSPSPENGIRSEKEVEMKEDSWKYFNSVSDQPVSRSDFM
SVLSNIEYILIKAAYGQGLQQSRIANISMEIAVKFEEMHLGRSRAHLIEQCRCPAGYAGF
SCQNCAPGYYREKPKEFSVRETHTIIAPCVPCQCNNHSETCDPETGKCLNCRDNTVGDYC
SACAPGYYGKVIGSVNDCSLCACPRANPVSFSPTCVLKGIQDYHCDACLPGYEGQYCEKC
SLGYYGDPQLPGGSCHLCQCNPSGSVHVNCDRVTGKCPCKQGVTGQLCEECEPRHLLLEE
ECVSCDDNCTGVLLNNLDSLSENILSLNLTGIVHVPSGILSELENATKHLKGLIVLREDR
TYSLATAGQSLLNLSRDVDQLPEESSRILRKASQLNTMTQETRSKSKELSGFIDTVHTAI
KVLAEVAMSLNETLGLGLPLSNVSSQSLQDDISTQLDELRKKDFVRRHYNATSVLKAAEG
LLHWVQKDYLKPQQELAELKKDASQLLSKHNSKLQDAQDLLNDALANINETNRLFPLISS
NLGELNEKKLSIKENKEVSTMLIKEGKFLVNAAAALSQDVKNSTTNLEVHQDELLQWNTN
LRHHVDELVMQMSVRGVLDLVYRAEDHAAQFQRLADALESGLSKVKDVTLNATAAVYTHS
SVKNVIERTESLADDASRVVNGPLDLPDESLGLLGKDTLQLSSKVQNEAKNLKKKSNGLL
SELNGLSKKVEKIQESTVKIVSHLNDSLLALKVLPNGTRKYMLEVKELAVSANTSAMVGL
SHFEDFSQKLLNTSSTLSQVNGTLRKTSELITDSSKAAMMAEKQVKEMEAQASLLLDRLK
PLKTLEENLSRNLSEIKELISQARKQAASIKVAVSADRDCVRAYQPQISSTNYNSLTLNV
KTTEPDNLLFYLGSNGKTDFLAVEMRRGKVALLWDLGSGSTRVEYPDFQIDNNKWHRIHA
TRFGKTGTLTIEEMNSNQKSSPKSATSPGTASILDVNKSTLMFIGGLGGQIKKSPAVKVT
HFKGCMGEASLNGKSIGLWNYIEREGKCSGCFGSPQDEDTSFHFDGRGYSVVEKALRSTV
TQIIIFFSTFSPNGLLLYLASNGTRDFLSLELVDGKVRLTVDLGSGPLALTTENRYNNGT
WYKISFSRNKKQGMLAVMDAYNLNYKETKQGEAPGVASDLNRSDKDPIFIGGLPKSRAVR
KGLNSRMYVGCIKNLEISRSTFDLLRNSYGVRKGCVLEPIRSMNILTNGYIELEPKSLSP
ESELMATFATKNSNGIILAGLGRGLEKRRRRQAHLPFFSIMLIDGHLAVHVNAGDRASTR
KVILRSPNGTYSDGQEHSVILIRNKRIITVQVDESNPSELRLGSSAEMSPMNISNFYAGG
IPAGEDFFGLKMTGSFYGCISNFIFNKELLDFTTSMKYEHVDMDSCFLSEKPKAAMQLED
MEIQAELPVPLRPPTDTKKLVACAKDELPGHVQGAHQFGLAKGSHLTLLFNQTAVRKKLS
VQLNLKTFASSGLIYYMAHQNQIDYAALQLLGGQLYFSFDLGKGRAVASHPAIVNDGKWH
TIRTEYVKRKGIIIVDGQELVSVSALGDGSTLDVEGKLYVGGLPIDYVAKNLGNVTHSIP
ACIGSMTINSKQLDKESPVSIFAVNKCYATVQDGTFFDGSGFAALVRDGYKVRSDVNITL
EFRTTAMHGVLLGISSAKVDAIGLEIVNGKVLFHVNNGAGRITATYEPGVANSLCDGKWH
KLQANTSKYRISLIIDGNLVQTDNPYIQSTSADTNNPIYVGGYPGDVKQNCLTSKSSFHG
CLRNLVLTRGQQAELFDFSRAFDLRGVFPHSCPGAQQ
Download sequence
Identical sequences ENSGALP00000036103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]