SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000036714 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000036714
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-32
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 153-346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000137
Family Pentraxin (pentaxin) 0.012
Further Details:      
 
Domain Number 3 Region: 854-1140
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000915
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000036714   Gene: ENSGALG00000013803   Transcript: ENSGALT00000037506
Sequence length 1195
Comment pep:known chromosome:Galgal4:3:52145374:52255811:-1 gene:ENSGALG00000013803 transcript:ENSGALT00000037506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSHINEMWCCHWKWKLQHCLYLFILYIICMQQAAHGCYNCRTVLTDPSGVFTSPCYPSD
YPNSQACKWIIRAPHGFIIQLTFSDFDIEEAPGCIYDSLTLDNGESPMNLCGITAKGLSY
NSTGNEMIVSFKSDFSIQKKGFNASYVRIAVSLRNQKVIIPQDPDADAVSVAETVLVPEL
SQFTLCFEATKSSSDDNDDWKIFSYTDASSKEFFGFGKTAKGHFLSISDTQCILDNALPQ
NAEFFTGTFEQLCVVGDSFSGTIGVYAKSIYHNTYCPDMFGKVIPGNGRLVLGSNSNEVS
SLNGDIYNFRLWNFTMNAQTLANLSCDVKGNIVDWENEFWSIPTSALKAENNLSCGSYLI
PSSAIEPTSCANLGSLCQATVNATTPTPPTVTTNMPDTNRTDKPNNGGLFYRISITVFSY
NSNSESKVHDVVAEWLNHTFQNWNYTVYVVNISIQPGTIKEAVREKRNIDSKRFEVLALL
VYNATNNINLEEQDIRQKLINNNESIAEGYRLHTVEVDPVEKCLAEENPPNYFWPDTRPT
VTNFTFCHGSSVQIASRTCYLGLQNYTSYWGQPDLRNCTENAADIANQLLNLTGEGQQLT
SDKVNDVVQKLKKIVNDEEIDESLGSTVVTIFSNILNSSDSVLAASSSEALKTIDALALK
IQFTGPSMSISTRNLALGVSSVNSTSFKGSSFSVSPQNNASDFQIDFDKDQTNAIASVIL
PPSLLKNLSQDDFEVISRAQFTFFNKNGLFQDAETPGNLTSFVVACSIGNITIRDLQEYV
KITIKHTKIQEDPKPTCVFWDMAKNGGNGGWNPTGCKVQADSNENETVCLCNHLTHFGVL
MDLQGTATEIDAQNTKILTFITYIGCGISAIFSAATLLTYIAFEKLRRDYPSKILMNLST
ALLFLNLTFLLDGWIASFDIDGLCIAIAALLHYFLLATFTWMGLEAVHMYIALVKVFNTY
IRRYILKFCIIGWGLPALVIAIVLASTNKNASRVYGKELYGRDATGQGGDDFCWIKNKVV
FYVTCAGYFGIMFLLNVAMFVVVMVQICGRNGKRTNRTLKEEILRNLRSVVSLTFLLGMT
WGFAFFAWGPLTLPFLYLFSIFNSLQGLFIFVFHCAMKENVQKQWRRHLCCGRFRLADNS
DWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSTTNTYCKRSSHTDNVF
Download sequence
Identical sequences ENSGALP00000036714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]