SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000036842 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000036842
Domain Number - Region: 113-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00111
Family Galactose-binding domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000036842   Gene: ENSGALG00000023084   Transcript: ENSGALT00000037636
Sequence length 246
Comment pep:novel chromosome:Galgal4:2:80772106:80776769:1 gene:ENSGALG00000023084 transcript:ENSGALT00000037636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLDEELAKVQRQLHVLQWRARDITERALHEALRRTELPGFTGEAVQKIIDQVLEKLEE
SPFQMTNYASRTSGAAIVRSKTSPSWIGSGRVFWQSLPLVAYMRPPEVILEPDNHPGNCW
PFPGSQGHVFIKLPVAVFPTAVTINHGVPAAAYHADSISSAPKDFAVYGLQAEDDEKGTL
LGEFIFTPGQAPGQTFQLKNEHSGFIKYVRLQVLSNWGHRDYTCVYQFRLHGDPAHDGDA
RGKLSA
Download sequence
Identical sequences A0A1L1RWV1
ENSGALP00000036842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]