SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000036843 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000036843
Domain Number - Region: 113-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00102
Family Galactose-binding domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000036843   Gene: ENSGALG00000013105   Transcript: ENSGALT00000037637
Sequence length 246
Comment pep:novel chromosome:Galgal4:2:79536612:79541020:1 gene:ENSGALG00000013105 transcript:ENSGALT00000037637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLDEELAKVQRQLHVLQWRARDITERALHEALRRTELPGFTGEAVQKIINQVLEKLEE
SPFQMTNYASKTSGAAIIRSKTSPSWIGSGRVFWQSLPLMAYMRPPEVILEPDNHPGNCW
PFPGSQGHVFIKLPVAVFPTAVTINHGIPAAAYHADSISSAPKDFAVYGLQEEDDEKGTL
LGEFIFTPGQAPGQTFQLKNEHSGFIKYVRLQVLSNWGHPDYTCVYQFRLHGDPSHDGDA
RGKLSA
Download sequence
Identical sequences ENSGALP00000036843 XP_015137784.1.86415 XP_015137785.1.86415 XP_015137788.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]