SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000037171 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000037171
Domain Number 1 Region: 160-237
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000149
Family Growth factor receptor domain 0.0023
Further Details:      
 
Domain Number 2 Region: 939-1003
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000115
Family VWC domain 0.0062
Further Details:      
 
Domain Number 3 Region: 527-587
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000366
Family VWC domain 0.01
Further Details:      
 
Domain Number 4 Region: 805-862
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000366
Family VWC domain 0.012
Further Details:      
 
Domain Number 5 Region: 882-937
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000732
Family VWC domain 0.007
Further Details:      
 
Domain Number 6 Region: 732-791
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000167
Family VWC domain 0.0034
Further Details:      
 
Domain Number 7 Region: 662-691
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.000000453
Family Huristasin-like 0.0045
Further Details:      
 
Domain Number 8 Region: 692-720
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.00000223
Family Huristasin-like 0.0076
Further Details:      
 
Domain Number 9 Region: 635-662
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0000628
Family Huristasin-like 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000037171
Domain Number - Region: 599-627
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0157
Family Huristasin-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000037171   Gene: ENSGALG00000010597   Transcript: ENSGALT00000037966
Sequence length 1162
Comment pep:known chromosome:Galgal4:3:31632109:31793597:-1 gene:ENSGALG00000010597 transcript:ENSGALT00000037966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRERAGGAGRGRLPPNGGRAEDALGAGRAAGRRRVGTRAASGAEAPPPPHPGARSRSR
AIAAPPAWTGPAAGGRGTHGPTDAASRRGQRAEPPPGAEVWLERPPPREETFLGGPEAGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQPGTRALVCLPCDESKCEEPKSCPGS
IVLGICGCCFMCARQRNESCGGVYGLHGACDRGLRCVIRPPLNGDSITEYEVGVCEDENW
DDDQLLGFEPCNENLITGCNIINGKCDCDTIRTCNNPFEFPSRDTCLSALKRIEEEKPDC
SKARCEVQFSPRCPEDSILIEGYAPPGECCPLPSRCVCNPAGCLRKVCQPGYLNILVSKA
SGKPGECCDLYECKPVFSVDCSTVECPPVQQVVCPLDSYETQVRLTADGCCTLPTRCECL
SGLCGFPMCEAGSVPQIVSRGDGTPGKCCDVFECVNEVKPTCIFNSMEYYDGDMFRMDAC
RFCRCQGGVSICFSAQCGELHCDRYYVPEGECCPVCEDPVYPVNNPAGCYANGQIQAHGD
RWREDDCTFCQCINGNPHCVATACGQSCLNPVKVPGECCPVCEEPTYITIGPPTCELLVN
CTLTEKDCIYSFKLDQNGCRICQCKTREELCTGLISGCSLDCSFGFQTDAHNCEICQCRP
RPKKCKPIVCDKYCPFGYLKNKHGCEICRCKKCPEMPCGKICPMGFQQNSHGCVICKCRE
ATASLMPPVKTGSCLSMDGRRHENEESWHDGCRECYCHNGREMCALITCPVPNCGNPTIH
PGQCCPSCPDEIIVQKPELTSPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRVLCETEV
CPPLLCQNPTRTQDSCCPQCPDEPLQPSLSSNVSMPSYCKNDEGDIFLTAESWKPNVCTS
CICMDGVIRCYSESCPPVSCERPVLRKGQCCPYCIEDTVPKKVVCHFNGKTYADEERWDI
DSCTHCYCLQGQTLCSTVSCPPLPCAEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGD
VELEVPNWSTPSENDIIHIHRDMNHLQGEYRSGNGPHPSEDASVSSVALVTVPITIALLV
IIVFLLINQKKQWIPVSCYKAPTKPSCLNNQLVYVDCKKGTMVQVDSSQRMLRIADPDSR
YSGFYSMQKQNNLQADNFYQTV
Download sequence
Identical sequences ENSGALP00000037171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]