SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000037775 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000037775
Domain Number 1 Region: 1831-1963
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-44
Family C-type lectin domain 0.000000753
Further Details:      
 
Domain Number 2 Region: 148-256
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-41
Family Link domain 0.0019
Further Details:      
 
Domain Number 3 Region: 518-628
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-40
Family Link domain 0.0011
Further Details:      
 
Domain Number 4 Region: 629-728
Classification Level Classification E-value
Superfamily C-type lectin-like 1.16e-29
Family Link domain 0.0057
Further Details:      
 
Domain Number 5 Region: 256-353
Classification Level Classification E-value
Superfamily C-type lectin-like 5.97e-27
Family Link domain 0.0024
Further Details:      
 
Domain Number 6 Region: 1964-2024
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 7 Region: 36-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000122
Family I set domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000037775   Gene: ENSGALG00000006725   Transcript: ENSGALT00000038569
Sequence length 2051
Comment pep:novel chromosome:Galgal4:10:12540523:12583712:-1 gene:ENSGALG00000006725 transcript:ENSGALT00000038569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLLVFVCLQAITTAASAELSDSSDGLEVKIPEQSPLRVVLGSSLNIPCYFNIPEEED
TNALLTPRIKWSKLSNGTEIVLLVATGGKIRLNAEYREVISLPNYPAIPTDATLEIKALR
SNHTGIYRCEVMYGIEDRQDTIEVLVKGVVFHYRAISTRYTLNFERAKQACIQNSAVIAT
PEQLQAAYEDGYEQCDAGWLADQTVRYPIHLPRERCYGDKDEFPGVRTYGVRETDETYDV
YCYAEQMQGKVFYATSPEKFTFQEAFDKCHSLGARLATTGELYLAWKDGMDMCSAGWLAD
RSVRYPISRARPNCGGNLVGVRTVYLNPANQTGYPHPSSRYDAICYSGDDFEALVPGLFT
DEVGTELGSAFTIQTVTQTEVELPLPRNVTEEEARGSIATLEPMEITATATELYEAFTVL
PDLFATSVTVETASPREENVTREEITGIWAVPEEVTTSVSGTAFTTGMAEVSSVEEAIAV
TATPGLESASPFTIEDHLVQVTAAPDVALLPRQPISPTGVVFHYRAATSRYAFSFIQAQQ
ACLENNAVIATPEQLQAAYEAGFDQCDAGWLRDQTVRYPIVNPRSNCVGDKESSPGVRSY
GMRPASETYDVYCYIDRLKGEVFFATQPEQFTFQEAQLYCESQNATLASAGQLHAAWKQG
LDRCYPGWLADGSLRYPIVSPRPACGGDAPGVRTIYQHHNQTGFPDPLSRHHAFCFRALP
SVVEEGVTSLFEEEVMVTQLIPGVEGIPSGEETTVETELSSEPENQTAQGTEVFPTDVSL
LSARPSAFPPATVIPEETSTNASIPEVSGEFPESGEHPTSGEPSASGAPDTSGEPTSVGF
ELSGEQSGIGESGLPSVDLQSSGFVPGESGLPSGDVSGLPSGIVDISGLPSAEEEVTVSV
SRIPEVSGMPSGAESSGLHSGFSGEISGTELISGLPSGEESGLASGFPTISLVDSTLVEV
VTAAPGRQEEGKGSIGVSGEEELSGFPSAEWDSSGARGLPSGAETSGEQSGVPELSGEHS
GVPGLSGEPFEVPELSGEHSGVTELSGEHSGLPELSGEPFGVPELSGFPSGLDISGEPSG
APEVSGPVDVSGLTSGVDGSGEVSGVTFISTSLQEVTTQSVAEAEAKEILEISGLPSGET
SGMVSGSLDVSGQPSGHIDFGGSASGVLEMSGFPSGAVESSGEASGVEVTSVLASGEESG
LTSGFPTVSLVDTTLVEVVTQTSVAQEVGEGPSGMIEISGFLSGDRGVSGEGSGAVQSSG
LPSGTGDFSGEPSGIPYFSGDISGATDLSGQPSAVTDISGEDSGLPEVTLVTSDLVEVVT
RPTVSQELGGETAVTFPYVFGPSGEGSASGDLSGGASAEGGIETSAAYEISGESSAFPET
SIETSTDQEISGEASAYPEISVETSTHLETSGETSAYPEISTETSTIQEVSGETSAFPEI
STETSTIQEISGETSAFPEIRIETSTFQEISGETSAFPEIRIETSTSQEARGETSAFPEI
TIEASTVHETSGETSAFPEISIETSTVHEISGESSAFPEIRIETSTSQEARGETSAFPEI
TIEASTIQEISGETSAFPEISIATSTVREISGETSAFPEIRIETSTSQEARGETSALPEI
TVETSTVHETSGEASAFPEISIETSTRQEARGEASAYPEVSIEASTTQEVSGESSAFPEI
SVETSTSQEARGETSAFPEIGIETSTAHEGSGETPGLPAVSTDTAATSLASGEPSGAPEK
ETPDTTSHLITGVSGETSVPDAVISTSAPDVELAQGPRNTEETQLEIEPSTPAASGQETE
TAAVLDNPHLPATATAALHPASQEAVDALGPTTEDLANCEEGWIKFQGHCYRHFEERETW
MDAESRCREHQAHLSSIITPEEQEFVNSHAQDYQWIGLSDRAVENDFRWSDGHSLQFENW
RPNQPDNFFSAGEDCVVMIWHEQGEWNDVPCNYHLPFTCKKGTVACGDPPVVENARTFGR
KKDRYEINSLVRYQCDHGYIQRHVPTIRCQPNGHWEEPRISCTNPSSYQRRLYKRSPRSR
LRPGVVHRPTH
Download sequence
Identical sequences ENSGALP00000037775 XP_015147465.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]