SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000037902 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000037902
Domain Number 1 Region: 122-233
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 2 Region: 4-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-20
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000037902   Gene: ENSGALG00000023421   Transcript: ENSGALT00000038694
Sequence length 575
Comment pep:known_by_projection chromosome:Galgal4:6:30920006:30927511:1 gene:ENSGALG00000023421 transcript:ENSGALT00000038694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEPQCGASLSDPNKALKINLNSNANCLWHIQRSENQTIRLIFSYFKFNPSSSCETESIK
VYDGPSSSNSPLLGQVCNNTDAVPVFQSSSNSLTFLITTNSVAFTRNFVSYYYFSPETTI
ENCGGSLTGPSGTFTSPNYPAAYPEFTYCVWHIQTTKNSKISLEFQDFFLELDQNCQFDF
LAVYDGLTTDTGLIGKACGVSRPTFESSSNAMTVVLSTDYANSYRGFSARYTSVLPSPPE
PDTSLTCSSDRMTIVLSKAYLDSLGYNETHLQLNDPSCRPVTTDQVIFSFPLSSCGTTKK
DEDLSITYTNAVTISESGNVITRKKIVQIIAKCIMEKNSTLEVIYVTENNIIQNTASVGR
YNVSMSFYDSDSFSSPVLESPYYVDLNQTLFAQVSLHSTDPNLLVFIDTCTASPQSDFGS
ITYDLIRSGCKKDDTVVTYQPLEHYGRFRFNAFRFLRRAPSVYLQCDVLICDSNNESSRC
TKGCVSRQKRETSSYTWKTKAVVGPIRLKRDRRAADHLESLTGTDAEETPNLQRYSFSTL
SVVVLISNIIIVVAVVVKYHMNCLSGSGYQKIPSS
Download sequence
Identical sequences ENSGALP00000037902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]