SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000037905 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000037905
Domain Number 1 Region: 61-166
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 
Domain Number 2 Region: 189-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-34
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000037905   Gene: ENSGALG00000023424   Transcript: ENSGALT00000038697
Sequence length 580
Comment pep:novel chromosome:Galgal4:6:30850164:30865241:1 gene:ENSGALG00000023424 transcript:ENSGALT00000038697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTNKILLFLLSAAILDATSETTTEYPWRTAQATTGYPSTYPWRTTLPTYTTTDVTSPTS
ASLSLVNGRNRCEGRVEIYSNGNRGTVCDDGWDINDANVVCRQLGCGFAVSALGNAYFGQ
GTGAIYLDDVHCKGNESSLFKCQSSGWGVHNCNHYEDASVVCSGAYTSTTVPTTPSSTPA
RKYFCGSFLSNSSGTIQSPFYPSNYPDNADCLWEIQVMNNYRIMLTFGSIRLQGGCQYDY
IEIYDGPPSTSPLLGKICSGYNIMYTSSSNMMTVRFRSDSRYSNRGFYADYHSFPADQNT
ALFCFPTHMRAVVERSYLQSQGYSVWNASLSDPSCRPKITSTQVIFDIPYNSCGTRRQSN
NETFTYSNVIRVFASDSIIKRKKDLHLHVNCKMLQKTWVQAMYIANDSGVTDIDETQYGR
YQVDFAFYNSSSFLLPVYDSPYYVDLNQNLFLQASLRSNDSNLVLFVDTCVASPDPNDFT
TLTYDLIRSGCAKDPTYSSYYSPYPSVSRFAFNAFSFVNRYPSVYLQCELVVCRYGDYSS
RCYQGCVSRFRRSAGSSQGKVSVVIGPVQLQETPPEKRSA
Download sequence
Identical sequences ENSGALP00000037905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]