SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000037999 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000037999
Domain Number - Region: 64-73
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00262
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 33-74
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0204
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000037999   Gene: ENSGALG00000023448   Transcript: ENSGALT00000038791
Sequence length 133
Comment pep:novel chromosome:Galgal4:Z:18492872:18493270:-1 gene:ENSGALG00000023448 transcript:ENSGALT00000038791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAERGGGSGCSAMPGGSDGPGGSDGAGGSGSLQAPKHLWRHEQHYPPQLRQHHFLQHQP
APGPPPPPPPPPPASRGRCLAGARVRHRGYSDTERYLYCRAMDRASYAVETGHRPGLKKS
RMSWPSSFQGLRR
Download sequence
Identical sequences ENSGALP00000037999 9031.ENSGALP00000037999 ENSGALP00000037999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]