SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038239 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038239
Domain Number 1 Region: 136-383
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-65
Family Nuclear receptor ligand-binding domain 0.0000000195
Further Details:      
 
Domain Number 2 Region: 68-150
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038239   Gene: ENSGALG00000005708   Transcript: ENSGALT00000039029
Sequence length 468
Comment pep:known chromosome:Galgal4:11:16459264:16479967:1 gene:ENSGALG00000005708 transcript:ENSGALT00000039029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLCQSIMDMDMPDYVDSLDSSYTMLEFENLRVLPNNNEEANGRCSMPAETITAESANTN
LLNNGIGSLCSICGDRATGKHYGASSCDGCKGFFRRSVRKNHVYSCRFSRQCVIDKDKRN
QCRYCRLKKCFRAGMKKEAVQNERDRISIRRSSYEDNGSLSISVLTQAEAMAQQYLPLSP
VHSADIAMKKVATINDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLL
GVAKRSIPYTDFLLLGNDFIIPMHCPELEIARVATRILDELVKPLRDIQIDDNEYACLKA
IIFFDPDCKGLSEPGKVKNMRFQVQVNLEDYINDRQYDSRGRFSDILLLLPPLQSITWQM
IEQVQFVKLFGVARIDSLLQEMLLGGTTVDVQYQSGPPSLNLDPLPGHVLPGNMSSVIHA
VPDPSPEPSLPSPSTSTGSEDYKLGSSAGPSAVAQLLPQTLIPKQEIL
Download sequence
Identical sequences ENSGALP00000038239 NP_001025747.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]