SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038541 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038541
Domain Number 1 Region: 469-603
Classification Level Classification E-value
Superfamily TIMP-like 1.33e-36
Family Netrin-like domain (NTR/C345C module) 0.013
Further Details:      
 
Domain Number 2 Region: 287-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000363
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 3 Region: 343-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 4 Region: 406-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 97-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000411
Family Galactose-binding domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038541   Gene: ENSGALG00000023626   Transcript: ENSGALT00000039331
Sequence length 606
Comment pep:known chromosome:Galgal4:18:2020996:2066954:1 gene:ENSGALG00000023626 transcript:ENSGALT00000039331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRGAEGPLALLLAAAWLAQPLRGGYPGLNMFAVQTAQPDPCYDEHGLPRRCIPDFVNS
AFGKEVKVSSTCGKPPSRYCVVTEKGEEQVRSCHLCNASDPKRAHPPSFLTDLNNPHNLT
CWQSDSYVQYPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYS
TQCRKMYNKPSRAAITKQNEQEAICTDSHTDVRPLSGGLIAFSTLDGRPTAHDFDNSPVL
QDWVTATDIKVTFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVRDR
DDNLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYK
LSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGAAGQTCNQ
TTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPPTAASSTEEPADCDSYCKA
SKGKLKINMKKYCKKDYAVQIHILKAEKNADWWKFTVNIISVYKQGSNRLRRGDQTLWVH
AKDIACKCPKVKPMKKYLLLGSTEDSPDQSGIIADKSSLVIQWRDTWARRLRKFQQREKK
GKCRKA
Download sequence
Identical sequences Q90922
NP_990750.1.86415 ENSGALP00000038541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]