SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038547 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038547
Domain Number 1 Region: 192-309
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-17
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 2 Region: 69-185
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000136
Family FCH domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038547   Gene: ENSGALG00000002383   Transcript: ENSGALT00000039337
Sequence length 324
Comment pep:known chromosome:Galgal4:Z:8924962:8928092:-1 gene:ENSGALG00000002383 transcript:ENSGALT00000039337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSVLYADLRFAKGPGGHSTTSQVLEADSVDDTDSPYENVVPGPAPVGTAGEGTQHSPG
HWSRRRCVPVGLLAAMLLLLVALVALGTCYWQVTHQLQNVSMEQATERGHFSQKAQVWEQ
NLEQTQQQLALVQEELQQAWQEAHHSQQELARREAELVRVSGALNVTQKELQDVQGKLSA
IKEAVSSLHVCLNGDCCPSGWLLYHGKCIFISAAKKSWWGSYWDCVEKHSRLLVQGESEL
WVLPHFLQSDSAKYWIGGIYQWPLDIQWLDKKPLSQGEWFAYCAATVSGKIVRKSCREEY
AWICEQAPNMSSVSERIFPLLAEG
Download sequence
Identical sequences F1NUD4
ENSGALP00000038547 NP_001026617.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]