SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038552 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038552
Domain Number 1 Region: 187-256
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000197
Family C-type lectin domain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000038552
Domain Number - Region: 70-184
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0209
Family FCH domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038552   Gene: ENSGALG00000021353   Transcript: ENSGALT00000039342
Sequence length 256
Comment pep:novel chromosome:Galgal4:Z:8920541:8923636:1 gene:ENSGALG00000021353 transcript:ENSGALT00000039342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSVLYADLRFAKGPGGHSTTSQVLEADSVDDTDSPYENVVPGPAPVGTAGEGTQHSPG
HWSRRRCVPVGLLAAMLLLLVALVALGTCYWQVTHQLQNVSMEQATERGHFSQKAQVWEQ
NLEQTQQQLAWVQEELQQAWQEPTTASRSWPGGAELVRVSGALNVTQKELQDMQGKLSAI
KQTASSLHVCLNGDCCPSGWLLYHGKCLFISAVKKSWWGSYWDCVEKHSHLLVQGESELW
VLPRFLQADGSMYWIG
Download sequence
Identical sequences ENSGALP00000038552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]