SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038939 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038939
Domain Number 1 Region: 46-117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000561
Family delta-Endotoxin, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038939   Gene: ENSGALG00000007456   Transcript: ENSGALT00000039730
Sequence length 575
Comment pep:novel chromosome:Galgal4:14:12044440:12086590:-1 gene:ENSGALG00000007456 transcript:ENSGALT00000039730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWRGGMGESTSPISVILVSSGSRGNKLLFRFPFQRGAEHPAAQANKPRSRYAVNSSGDTS
EDQDGDSRFSDVILATILATKSDMCGKKFELKIDNVRFVGHPTLLQHALGQVSKTDPSPK
REMPTMILFNVVFALRANADPSVINCLHNLSRRIAIVLQHEERRCQYLTREAKLILAIQD
EVSAMSETTEGPQSPFHHILPKCKLARDLKETYDSLCTTGVVRLHINNWLEVSFCLPHKI
HYVATNFIPPEAIERSLKSISRPYHALLLLNDEKSLLNELPLDCSPALVRVIKTTSAVKN
LQQLAQDADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNASVCLYSPLADAFSC
QFRGHNLPSMLSKFSLPVSLSEFKNPLVPPVQETQLIQMVIWMLQHRLLIQLHTYVCLMV
PPNEEEFRAQDEDMPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELIPGG
DSPLNKRMTENLLASLLEHEREAILNVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNEN
MRRSQLLMLFDKFRSVLVVTSHEDPVISVFQSLLK
Download sequence
Identical sequences ENSGALP00000012043 9031.ENSGALP00000038939 ENSGALP00000038939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]