SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038993 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038993
Domain Number 1 Region: 650-951
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-80
Family Protein kinases, catalytic subunit 0.000000000295
Further Details:      
 
Domain Number 2 Region: 64-235
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.74e-72
Family Ephrin receptor ligand binding domain 0.000000274
Further Details:      
 
Domain Number 3 Region: 364-569
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-40
Family Fibronectin type III 0.0000851
Further Details:      
 
Domain Number 4 Region: 947-1020
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.53e-22
Family SAM (sterile alpha motif) domain 0.00011
Further Details:      
 
Domain Number 5 Region: 293-363,402-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000217
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038993   Gene: ENSGALG00000008537   Transcript: ENSGALT00000039784
Sequence length 1023
Comment pep:known_by_projection chromosome:Galgal4:9:15437757:15449465:-1 gene:ENSGALG00000008537 transcript:ENSGALT00000039784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STGGGAQGAGRWGAGGRAGGGNVSPCHLAGCSAGTPRSSCSDSRAEIWSLSAPLPLLPPR
LTPQETLMDTKWVTSELAWTTHPETGWEEVSGYDEAMNPIRTYQVCNVREANQNNWLRTK
FIQRQDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYESDTDSASANSPFWMENPYI
KVDTIAPDESFSKLESGRVNTKVRSFGPLSKNGFYLAFQDLGACMSLISVRAFYKKCSNT
IAGFAIFPETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEWMVPVGACTCAAGY
EPAMKDTQCQACGPGTFKSKQGEGPCSPCPPNSRTTAGAATVCICRSGFFRADADPADSA
CTSVPSAPRSVISNVNETSLVLEWSEPQDAGGRDDLLYNVICKKCSVERRLCTRCDDNVE
FVPRQLGLTERRIYISNLMAHTQYTFEIQAVNGISSKSPYPPHFASVNITTNQAAPSAVP
TMHLHSSTGNSMTLSWTPPERPNGIILDYEIKYSEKQGQGDGIANTVTSQKNSVRLDGLK
ANARYMVQVRARTVAGYGRYSLPTEFQTTAEDGSTGKTFQELPLIVGSATAGLLFVIVVV
IIAIVCFRKQRNSTDPEYTEKLQQYVTPGMKVYIDPFTYEDPNEAVREFAKEIDISCVKI
EEVIGAGEFGEVCRGRLKLPGRREIFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNII
HLEGVVTKSRPVMIITEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYV
HRDLAARNILVNSNLVCKVSDFGLSRFLEDDPADPTYTSSLGGKIPIRWTAPEAIAYRKF
TSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCW
VRDRNLRPKFAQIVNTLDKLIRNAASLKVIASVQSGVSQPLLDRTVPDYTTFTTVGDWLD
AIKMGRYKENFVNAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLP
VQV
Download sequence
Identical sequences ENSGALP00000038993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]