SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039229 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039229
Domain Number 1 Region: 549-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000392
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 605-660
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000693
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 662-710
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000366
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 496-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 750-802
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000051
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 438-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039229   Gene: ENSGALG00000012027   Transcript: ENSGALT00000040022
Sequence length 802
Comment pep:known chromosome:Galgal4:5:5838066:6002800:-1 gene:ENSGALG00000012027 transcript:ENSGALT00000040022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARLRPLALRLLALTFPLVARGFSDETLEKAAKSEGYCSRILRAQGTRREGYNEFSLRV
EGDPEFYKPGNSYRVTLSAATPAYFRGFTLIALKEGKEGDKEEDHAGTFQIIDEEETQFM
SNCPVAVTESTPRRRTRIQVFWTAPPTGTGCVILKASIVQKRIIYFQDEGSLTKRICEQD
SASEGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDFPRRTNHWSAIIGSSHSKNYIL
WEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEF
SVDRHRHLMSFLTMLGPSPDWNVGLSAEDLCTKDCGWVQKVVQDLIPWDAGTDSGVTYES
PNKPTVPQEKIRPLTSLDHPQSPFYDPEGGSIKLVARVVIERIARKGEQCNIVPDNIDDI
VADLAPEEKEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQD
FQPCMGPGCSDEDGSTCMMSDWITWSPCSVSCGMGTRSRERYVKQFPEDGSMCKVPTEET
EKCIVNEECSPSSCLVTEWGEWDECSASCGTGMKRRHRMIKMTPADGSMCKAETTEAEKC
MMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSAAELGDCNEELEQAEKCMLPEC
PIDCELTEWSQWSECNTSCGKGHMIRTRMIKIEPQFGGTACPETVQRTKCRVRKCLRGPG
MEKRRWKEAREKRRSEQAKKNIDNEQYPVCRLKPWTAWTECSTLCGGGIQERYMMVKKRS
KSTQFTSCKDKKELRACNVHPC
Download sequence
Identical sequences A0A1D5PMF7
ENSGALP00000039229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]