SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039526 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039526
Domain Number 1 Region: 145-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.04e-17
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 2 Region: 396-459
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.00056
Further Details:      
 
Domain Number 3 Region: 86-156
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 210-279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000852
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 5 Region: 270-341
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000653
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 334-391
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000973
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 7 Region: 24-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000256
Family Complement control module/SCR domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039526   Gene: ENSGALG00000023950   Transcript: ENSGALT00000040327
Sequence length 481
Comment pep:known chromosome:Galgal4:26:2599568:2605277:1 gene:ENSGALG00000023950 transcript:ENSGALT00000040327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGTALLWLSAALLALPGVCGDCPQPPRFSFAEPPGPTNSSYPVGAVLRYRCRPGYTGD
RNKLPSVTCLPNSTWASDPDFCIGKSCGQPEIPNGNFHFSTNLQFGATINFTCKAGYRLV
GKPTAQCILSGSDVVWDAVPYCEIIPCQPPPPIENGTPSSVHGEYTFGVAVTYSCKKGLS
LIGNATIHCTMDDNLNGIWSGPAPECKDVRCEKPEVENAKNLNSFATEYTYGEKVSFECA
PGHALSGAQTVTCDADNTWKPSLPSCDPRYCGSPPSIPSAELIGAAGNSFMAGTKLTYQC
QPGFTTESGKSLEVTCLMDATWTSGSVLCTRQQCTAPTIPNGIVNGDSFLFGTTVTFSCN
AEYELKGSSSAKCVAVESGVEWDVKLPSCERRRSDVLCEQPPSIGNGVHNGTGGTAFPLG
SVVVYSCNDGFNLVGDRAIQCLATTQDRGVWSTPTPECRGGASSIIVGILPLLLAMLVMN
F
Download sequence
Identical sequences F1P386
9031.ENSGALP00000039526 ENSGALP00000039526 ENSGALP00000039526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]