SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039538 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039538
Domain Number 1 Region: 99-170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-18
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 2 Region: 541-605
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-17
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 3 Region: 230-301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000183
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 4 Region: 422-485
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 5 Region: 159-228
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.00023
Further Details:      
 
Domain Number 6 Region: 349-417
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 7 Region: 291-359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000361
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 480-551
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 9 Region: 35-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000367
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 597-660
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000486
Family Complement control module/SCR domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039538   Gene: ENSGALG00000023953   Transcript: ENSGALT00000040338
Sequence length 713
Comment pep:known chromosome:Galgal4:26:2576519:2583374:1 gene:ENSGALG00000023953 transcript:ENSGALT00000040338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMVSALGSARPRGRAAVLVLLLTAALVVGTQGACSAPPRFSFAELKEGYLHNRTFSTSD
VVEYNCRPGYMRNTMARNTFICEKNRWKGSSNFCLPRPCSYPGEPMNGRLVEAEQFTFGS
TANYSCDTGYRLIGNSQIRCVIKDGHVAWDGDVPTCEPIPCLPPPVIANGEHNGGHIELF
TYGASVTYHCHADIRGRKHFSLVGDASIFCTTIDNVNGVWNKPAPECKEVSCREPHVEHG
RLQSRYRAEYTYGDTIIFDCEFRYALLGSDTATCQEDGSWDPPPPQCQRSSCDDPPDVQN
AVKARLAGNLFPIETVITYECKTGYEFSPGVVMEHISCQPDYTWTEVPPPCKRISCPNPA
TKTGMQISFWDRKDTYVFGDRVRIICDPGYVFKDRDDHVMLQCTNNGTWNRAAPECIPEP
HCPKPAVDHGREAYNSKNDYTVGTKVRIECDEGYTLSTQQLVTCQADGNWFPSLPYCQKA
CGPPPQSTSGLNVNATSSSFPYGYRVEYSCAAGLSLIGDESLYCTSEDGVNLEWSGPAPE
CRVVHCPKPVVENGEMVTLRHTFPYGTSVSFYCKEGFMLRGSAESRCVADGTWQPALPKC
QPVKCSAPRSKENLQFFPVKGEYEFKESLYFSCKLNNNAADRALTTCSTGGSWMPPPNCK
TFYVRKKIDQIKETFDCGLPLAELRTLLEVQKLYLEIQKLEKELGAKGSRWWP
Download sequence
Identical sequences F1P2M6
ENSGALP00000039538 9031.ENSGALP00000039538 ENSGALP00000039538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]