SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039890 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039890
Domain Number 1 Region: 282-458
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.16e-27
Family Prokaryotic proteases 0.0097
Further Details:      
 
Domain Number 2 Region: 135-240
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000239
Family Prokaryotic proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039890   Gene: ENSGALG00000020997   Transcript: ENSGALT00000040687
Sequence length 493
Comment pep:known_by_projection chromosome:Galgal4:6:11069708:11072524:-1 gene:ENSGALG00000020997 transcript:ENSGALT00000040687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDGTAVPWELPGCVVSVSDPSEPDVEPSSCSGAILCRSPGLVLCPAAVLVPFLQPDVT
AWPHGDALPPSALRPGLHISVLQAAPPPDAVQQHVACPLALLRCDAFARALPGTLSTAEE
STEALPWFCWLRVPGLDTPGGTWTPWAPAATLRKGAALLACGTPFGALCPELFLNALSTG
VLSNATGPQRALLLTDARCLPGTQGGPVLALAPTSSPPRLVAVVAATAGCQGGQGLGLAL
LCSLHALLQSARSVLPELSSLPPPLPLPEAHGSPTLRCAALVESGSSWGSGTLVAPRLLL
TCRHVLQLGAPLRVTLRHSTTRDTILQARLVFATAETSPFDVAVLELQDSVPSFQPPDLA
TTFQPGEAVLVLGFGALGRACGPSVTGGVLSAVVGTPPVMLQSTCAVHAGSSGGPLLSAH
DGCLLGIVASNARDNTAGTTYPHLNFCIPISLLRTPLARYRCSGNPAAFAPLNAASEGAR
AAWRLQQRPPSKL
Download sequence
Identical sequences A0A1D5P8S7
ENSGALP00000039890 XP_001232633.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]