SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000040104 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000040104
Domain Number 1 Region: 38-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-37
Family G proteins 0.000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000040104   Gene: ENSGALG00000000606   Transcript: ENSGALT00000040899
Sequence length 184
Comment pep:known_by_projection chromosome:Galgal4:26:342278:351381:-1 gene:ENSGALG00000000606 transcript:ENSGALT00000040899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALFNKLLDWFRALFWKEEMELTLVGLHLLMLFGLSLQSGQFNEDMIPTVGFNMRKITK
GNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQG
IPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSK
SRRS
Download sequence
Identical sequences ENSGALP00000040104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]