SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000040258 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000040258
Domain Number 1 Region: 339-461
Classification Level Classification E-value
Superfamily TIMP-like 5.34e-19
Family Tissue inhibitor of metalloproteinases, TIMP 0.022
Further Details:      
 
Domain Number 2 Region: 34-86
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000497
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000040258   Gene: ENSGALG00000024298   Transcript: ENSGALT00000041053
Sequence length 467
Comment pep:known_by_projection chromosome:Galgal4:28:3128805:3132148:-1 gene:ENSGALG00000024298 transcript:ENSGALT00000041053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPSLSLLHRSWWPWRALLLAWLSLGCGIGTTQSAHGAWGSWGPWSACSSSCGDGVALRTR
RCLRSAEEEPCIGDQRQYRLCQLQGCPGGSVPFRAMQCSLYDDTPVQGMQTRHRWVPFYG
APNVCDLNCLAVGHNFYYTFGRVLDGTRCRPGSTDLCVGGRCLSVGCDGILGTGAQPRVC
SRCGGGQDGCLFVHRLFQDTEPFSGHFGYMNVTKIPAGATNIKVTDKSRNFLALMRSDGR
YVLNGDWSIAWPGPYEVAGTQLLYARSPDGTESLEAPGPTALPLDAQVLLQEPNPGIEYE
FWLPRGHPQHSMVDTSALRQPQPRGAGSPPPAEPPLPTVPPRRCGRCHPPKGRSQRIRHF
CQSDFVFRARILARRSVGQEMRYEVQVVTPYRHRFPMVPREYVWVPDTCGCPTLLGGHDY
VLMARRHVNYEHTLNRILLQRDGYARPWSPREERAVRDAGRHCAHLR
Download sequence
Identical sequences ENSGALP00000040258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]