SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000040351 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000040351
Domain Number 1 Region: 136-253
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-30
Family C-type lectin domain 0.0000803
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000040351
Domain Number - Region: 101-132
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0464
Family Triple coiled coil domain of C-type lectins 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000040351   Gene: ENSGALG00000002507   Transcript: ENSGALT00000041145
Sequence length 254
Comment pep:known chromosome:Galgal4:6:3981178:3989358:-1 gene:ENSGALG00000002507 transcript:ENSGALT00000041145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLQPFSALLLCLSLMMATSLLTTDKPEEKMYSCPIIQCSAPAVNGLPGRDGRDGPKGE
KGDPGEGLRGLQGLPGKAGPQGLKGEVGPQGEKGQKGERGIAVTDDLHRQITDLEAKIRV
LEDDLSRYKKALSLKDFVNVGKKMFVSTGKKYNFEKGKSLCAKAGSVLASPRNEAENTAL
KDLIDPSSQAYIGISDAQTEGRFMYLSGGPLTYSNWKPGEPNNHKNEDCAVIEDSGKWND
LDCSNSNIFIICEL
Download sequence
Identical sequences Q98TA4
ENSGALP00000040351 ENSGALP00000003943 NP_989680.2.86415 9031.ENSGALP00000040351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]