SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000040356 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000040356
Domain Number 1 Region: 8-114
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-27
Family C-type lectin domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000040356   Gene: ENSGALG00000024343   Transcript: ENSGALT00000041151
Sequence length 142
Comment pep:novel scaffold:Galgal4:AADN03010694.1:32:1108:1 gene:ENSGALG00000024343 transcript:ENSGALT00000041151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIPTLCPTFVQFLISARWPVPVPPFPAFGHACPNAWVGFQGKCYYFSEEENDWNSSREH
CNAHGASLATIGSAEEMDFMMRFQGPANCRIGLHREEEDAQWTWHDATAFTNWSVCLSSC
HDFPRALFEMGTFSWCHSHGFA
Download sequence
Identical sequences ENSGALP00000040356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]