SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000040482 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000040482
Domain Number 1 Region: 31-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000040482   Gene: ENSGALG00000021688   Transcript: ENSGALT00000041277
Sequence length 122
Comment pep:known chromosome:Galgal4:28:891185:894317:1 gene:ENSGALG00000021688 transcript:ENSGALT00000041277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLLELLVLLRAVRPLPTPTSAPGNGSLAQCSPEQFHCSEPHDPQTDCYPLEWLCDGHP
DCDDGRDEWGCGASGSPAVPTAGGTETSAVPAPGRALPSRNHGRMWMLIVAGIFHCEVVR
WD
Download sequence
Identical sequences F1NTT4
ENSGALP00000040482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]