SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000040683 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000040683
Domain Number 1 Region: 15-97
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000000161
Family beta-glycanases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000040683   Gene: ENSGALG00000027563   Transcript: ENSGALT00000044531
Sequence length 105
Comment pep:novel scaffold:Galgal4:AADN03016590.1:21:1322:1 gene:ENSGALG00000027563 transcript:ENSGALT00000044531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWGLRGQPRFSPPQVLKDPVAASYISGIGIHWYLDFLAPIDLTLSITHHLFPNYFLLST
EASTGSYFWEPRVVLGGWERGSKYSHSILTDLNNYVTVGPTGTWR
Download sequence
Identical sequences A0A1D5PDM5
ENSGALP00000040683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]