SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000040782 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000040782
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-71
Family Eukaryotic proteases 0.000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000040782   Gene: ENSGALG00000027189   Transcript: ENSGALT00000043604
Sequence length 230
Comment pep:known chromosome:Galgal4:21:6521864:6524784:-1 gene:ENSGALG00000027189 transcript:ENSGALT00000043604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QISLQYERDGTFSHTCGGTLIAPDWVMTAAHCISSTLTYEVVLGEYDMSSAEGPEQRIPV
AADDIFVHPKWNRFCAACGNDIALLKLRRNAVLNDYVQTGRLPPAGTVLPNGYPCYLSGW
GRLTTGGPLPDKLQDALMPVVDHEQCTQPDWWGSLAIRTTMICAGGAEQAGCNGDSGGPL
NCQAEDGQWEVHGIASFVSSLGCDTPKKPTVFTRVSAFNDWIAETMENNS
Download sequence
Identical sequences ENSGALP00000040782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]