SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041070 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041070
Domain Number 1 Region: 344-455
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 2 Region: 526-632
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-19
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 170-285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000183
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 4 Region: 638-702
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000553
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 697-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 284-346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000025
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 460-524
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000958
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 765-824
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000528
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041070   Gene: ENSGALG00000026431   Transcript: ENSGALT00000046159
Sequence length 922
Comment pep:known_by_projection chromosome:Galgal4:19:5911368:5923338:-1 gene:ENSGALG00000026431 transcript:ENSGALT00000046159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAEGDPTALPTPAEREAEARFVSTAPTLKLLNHHPLLEDLLHEAFLKKDYLAQAPFPPGL
PGPVLPDEALRPDPGPPAQHIPPRAPALPRVAFPTAPLTTPAGRSGPWGEPWGVAPGTDP
SQPPTGGSGSSPAAPSQAPILGTTGVSGDEEGTTTTSTITTTTVTTLQGPAPCNRTLAGP
EGWLVSPEPASAPYDSSMDCTYTISVYPGYGVEIKVQNISLADGETLTVESAGGLEPAVL
ANESFLLRGQVIRSPANVLTLRFQSPRSTSPGSYRFQYQAYLLSCPFPARPAFGDVSVSS
LHPGGDARFRCTTGYQLQGAHLITCRNATRPFWSAREPQCMAACGGAIRNATVGRVVSPG
FPGNYSNNLTCHWLLEAPVGHRLHLHFEKVSLAEDDDRLIIRNGNNVEAPPVYDSYEVEY
LPIEGLLSTGRHFFVELTTDSSGAAAGMALRYEAFEQGHCYEPFVKYGNFTTSDPRYPVG
TTVEFSCHPGYTLEQGSTIIECVDPSDPQWNETEPACRAVCSGELMDTAGVVLSPNWPEA
YGKGQDCIWGLHVEEDKRVMLDIRVLRLGAGDVLTFYDGDDLTARILGQYTGARGRFKLF
ASSADVTIQFQSDPGAGVFAYRQGFVIHFSEVPRNDTCPELPDIANGWKTASQPELLHGT
VVTFHCYPGFELAGADLLMCHWDLTWSGDLPSCERVTTCRDPGDAEHSRRVVSSPKFPVG
STVRFVCDKGYVLAGAGLLTCHDRASGGPKWSDRLPKCIPEAYEPCHNPGVPAGGRQSPE
RRLYPAGSTLRFSCTAGRALLGEGNLRCLPGHPSRWSGSPPICKAASYDEFYSNRNLDAV
AKAVPSETALEGTNVAIAIFLPVLVLALLIGGVYLYFSKLQGKPALQLPLSGSHPYDHIT
VESAFDNPTYETGETREYEVSI
Download sequence
Identical sequences ENSGALP00000041070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]