SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041263 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000041263
Domain Number - Region: 226-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 662-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 473-566
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0235
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number - Region: 359-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041263   Gene: ENSGALG00000028622   Transcript: ENSGALT00000045144
Sequence length 1016
Comment pep:known_by_projection chromosome:Galgal4:25:404204:413641:-1 gene:ENSGALG00000028622 transcript:ENSGALT00000045144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRTVALALHACLLAALHPSDPNVCSYWESFTVAVKESYAKPHIVTSTEPCTGTPGLPQ
SCPQQRVVYRTEYRQAVRTDYRRRYQCCLGYYESRDACVPRCTQECVHGRCVAPERCQCE
PGWRGHDCSSACDERLWGKNCEHHCDCHHGAPCNPLSGVCACPPGFTPPLCHQPCPPGSY
GPDCRLHCPCHHGAPCNASTGACLCPPGLAGPLCEVLCPEGTPCGTHCPCQNGGICHPPG
SSTCVCPHGWMGDICSIPCPPGRFGPSCQGECRCHNGGRCDPLGGQCRCAPGFTGEQCRE
RCPVGRYGQDCQESCDCANGGQCFHVDGACLCEAGFQGSRCEEPRCLPGLYGIQCQSRCL
CHPQHSQSCHPLLGECSCRPGWAGLFCNESCPPGSFGAGCLQLCLCLNGGTCDGTTGRCH
CPPGYTDEHCSSLCPSDTFGVNCSEHCSCQHGVACSPIDGSCICKEGWHGPDCSTPCPDG
TWGPGCNQSCDCAHGATCSAQSGVCSCTPGWHGPRCHQSCPNGTFGAGCGQRCECDHADG
CDPITGECHCLPGWTGLQCKQSCPQGSWGRGCRQLCVCRNGASCSPEDGSCTCTPGFRGP
TCQRQCPPGRYGKRCALSCSCANGSSCHHATGACLCAAGWSGPHCSQPCTPGSWGDACSQ
RCQCHQRGTCDPVEGTCHCPAGWTGSSCEEECPPGTFGLQCEQLCRCPHNATCHPVSGTC
PCAPGRSGPHCEAGNPDQPYTIVPAPPLAYSTLGMVVSLVALVALLVAVVAVALCYRHRQ
KGKENRHLAVAYTAGRTDTSEYVVPDVPPNHTHYYSNPSYHTLSQCTLPAHSSQDRASSL
KVPTSQPFHGAERPYGPEGNATLPPDWKHLGAPPQEARGGGQMDRSYSYSYSCSMGKYYG
TEHPQEGLRASGSSLASENPYATIKDVPSPLAKASEGSYMEMKSPVQREMSYAEIGLLEE
PDGNEEESSPGGAEDTAAARDVRSHYDSPKNSHIPSHYDVPPVRHPPSPPLRRKDR
Download sequence
Identical sequences R4GGU0
XP_015153920.1.86415 XP_015153921.1.86415 ENSGALP00000041263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]