SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041452 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041452
Domain Number 1 Region: 150-327
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.27e-53
Family Phosphonoacetate hydrolase 0.0081
Further Details:      
 
Domain Number 2 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000811
Family Somatomedin B domain 0.002
Further Details:      
 
Domain Number 3 Region: 105-146
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000112
Family Somatomedin B domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041452   Gene: ENSGALG00000016428   Transcript: ENSGALT00000043423
Sequence length 372
Comment pep:known chromosome:Galgal4:2:136134362:136163574:-1 gene:ENSGALG00000016428 transcript:ENSGALT00000043423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKGCFYFHQVISLFAFAFGVNVCMGFTTNRFRRSEEWDEGPISVLSDSPWISTSGSCK
NRCFELQEAEPPGCRCDNLCKSYNSCCFDFDELCLKTARGWECTKDRCGETRNDDNACHC
SEDCLSRGDCCTNYQVVCKGETHWVDDDCEEIKTPECPAGFVRPPLIIFSVDGFRASYMK
KGNKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
SFSLRGREKFNHRWWGGQPIWITAAKQGVKAGTFFWSVVIPHERRILTILQWLTLPDNER
PYVYAFYSEQPDAAGHRYGPFNSEIYTTERALKHIEIWHCYTVPAAPLTRCLETAIVSVQ
TWVSYARVFLAY
Download sequence
Identical sequences E2RUH1
ENSGALP00000041452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]