SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041523 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041523
Domain Number 1 Region: 3-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-73
Family PAPS sulfotransferase 0.00000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041523   Gene: ENSGALG00000011287   Transcript: ENSGALT00000044068
Sequence length 284
Comment pep:known chromosome:Galgal4:3:41122363:41158394:-1 gene:ENSGALG00000011287 transcript:ENSGALT00000044068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQGVLYPVALCSPEVFRAMESFEARSDDVILAGYPKSGTNWVGQILSDLVATFEKERL
EEKSVNDEELEEFPYLEIGDTEKYERMKKLPSRRVILTHLSPEKLPKSIFKNKAKILLLI
RNPKDIATSFFHFSNAWSALPSYETWDDFFIAFMTEKMPWGSYFNYLSEWNKYAADENVM
TITYEELKENQTLGVKNIASFFGISLTGEELRSVIERSSFQSMKENSLKTHGALGSMLFR
KGGVSDWKNLFNEEQNEKMDKVFEERIARTKLGTKLKYEVYCKA
Download sequence
Identical sequences ENSGALP00000041523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]