SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041617 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041617
Domain Number 1 Region: 147-446
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.08e-90
Family Nuclear receptor ligand-binding domain 0.00000000699
Further Details:      
 
Domain Number 2 Region: 44-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.00000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041617   Gene: ENSGALG00000026166   Transcript: ENSGALT00000045912
Sequence length 451
Comment pep:known scaffold:Galgal4:JH375554.1:96208:126245:1 gene:ENSGALG00000026166 transcript:ENSGALT00000045912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELRGSWDAQQQSMAYLPDADMDTVAASTSLPDPAGDFDRNVPRICGVCGDRATGFHFN
AMTCEGCKGFFRRSMKRKAMFTCPFNGDCKITKDNRRHCQACRLKRCVDIGMMKEFILTD
EEVQRKREMILKRKEEEALKESLKPKLSEEQQKVIDTLLEAHHKTFDTTYSDFNKFRPPV
RSKFSSRMATHSSSVVSQDFSSEDSNDVFGSDAFAAFPEPMEPQMFSNLDLSEESDESPS
MNIELPHLPMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEVIMLRSN
QSFTMEDMSWTCGSNDFKYKVSDVTQAGHSMDLLEPLVKFQVGLKKLNLHEEEHVLLMAI
CILSPDRPGVQDTSLVESIQDRLSDILQTYIRCRHPPPGSRLLYAKMIQKLADLRSLNEE
HSKQYRCLSFQPEHSMQLTPLVLEVFGNEIS
Download sequence
Identical sequences A0A1D5PI18
ENSGALP00000041617 XP_015128089.1.86415 XP_015128090.1.86415 XP_015128091.1.86415 XP_015128092.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]