SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000041629 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000041629
Domain Number 1 Region: 280-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-19
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 2 Region: 154-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.47e-19
Family Complement control module/SCR domain 0.00041
Further Details:      
 
Domain Number 3 Region: 336-401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 215-291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000486
Family Complement control module/SCR domain 0.00062
Further Details:      
 
Domain Number 5 Region: 464-520
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000275
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 6 Region: 399-461
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000524
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 90-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000275
Family Complement control module/SCR domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000041629   Gene: ENSGALG00000026069   Transcript: ENSGALT00000043525
Sequence length 564
Comment pep:novel chromosome:Galgal4:26:2614391:2618174:1 gene:ENSGALG00000026069 transcript:ENSGALT00000043525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPSNPEWEDSASSSEHLRTQGHCHLRVRARLCHPRPQSGAVPAEQHLAAPSAHLRARQ
VAGQHCRCHPAPVSPDPLIRCWLVSPTAGCRAPPRLVFAELKEPYRNQTAFPVGGTVEYT
CQPGYARHVGMSPTITCLGNQSWSVALEFCKRKQCENPEDPQNGRAVVLTDLLLGSKVNY
TCDEGYKLIGHSQRTCEVSGTRVAWSGDAPICHRIVCDPPPDIPHGTHSGGLMDVFPYMT
VVTYTCEPGRVLAGTASIFCNTVDGKRGAWSGPPPRCGEVQCPPPPSIANGKHSSQPLDT
FLPGAAVQYTCKDGYMLTGNASITCTAAGTWSWPQPRCEVVQCPSPPNITHGQYSSEDVR
VFIPGTSVRYKCEPGYVLTGKTALTCLTSGVWSIPYPQCKAVTCMSPSIKHGEVAEGQQA
VYHPGTIITIRCHPGYMLRGSQEPKCHSDGRWVPSVPSCEPALPCPPPPTIAHGIHDAEL
GANFTSGMSVNYSCQPGFSLLGDPSIQCMEGSWSLPYPRCAGEGPTQHSMAWHAAPKLRC
GNFGGELQFQHSALSYLSLQTPAL
Download sequence
Identical sequences ENSGALP00000041629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]